DSIP is a naturally occurring nonapeptide studied in experimental models as a neuropeptide associated with central nervous system signalling and neuroendocrine pathways.

• Batch tested Purity: ≥ 99 % (HPLC, typical)
• CAS Number: 69431-45-4
• Molecular Formula: C₃₅H₄₈N₁₀O₁₅

Ipamorelin is a specialised research peptide used in scientific investigation of growth hormone secretagogue activity, selective ghrelin receptor (GHS-R1a) signalling, and neuroendocrine regulatory pathways.

• Batch tested Purity: ≥ 99 % (HPLC, typical)
• CAS Number: 170851-70-4
• Molecular Formula: C₃₈H₄₉N₉O₅

Kisspeptin-10 is a specialised research peptide used in scientific investigation of hypothalamic–pituitary–gonadal (HPG) axis signalling, receptor-mediated neuroendocrine regulation, and gonadotropin-releasing hormone (GnRH) pathway activity.

• Batch tested Purity: ≥ 99 % (HPLC, typical)
• CAS Number: 374675-21-5
• Molecular Formula: C₆₃H₈₃N₁₇O₁₄

KPV (Lys–Pro–Val) is a tripeptide derived from the C-terminal fragment of α-melanocyte-stimulating hormone (α-MSH 11–13), used in experimental research to investigate melanocortin-related signalling and inflammation-associated cellular pathways.

• Batch tested Purity: ≥ 99 % (HPLC, typical)
• CAS Number: 67727-97-3
• Peptide Type: Synthetic tripeptide (α-MSH(11–13) / ACTH(11–13) fragment)
• Amino Acid Sequence: Lys-Pro-Val (KPV)

PT-141 is a specialised synthetic melanocortin peptide developed for advanced scientific exploration of melanocortin receptor signalling (MC3R / MC4R) and central neuropeptide pathways, commonly studied in models of motivation, reward, and neuroendocrine signalling.

• Batch tested Purity: ≥ 98% (HPLC, typical)
• CAS Number: 189691-06-3
• Molecular Formula: C50H68N14O10
• Amino Acid Sequence: Ac-Nle-cyclo(Asp-His-D-Phe-Arg-Trp-Lys) (cyclic lactam; contains D-Phe)

Selank is a specialised synthetic heptapeptide developed for advanced scientific exploration of GABAergic modulation, neuropeptide signalling, and stress-response pathways, frequently studied in models of anxiolytic activity, immune modulation, and neuroplasticity.

• Batch tested Purity: ≥ 98% (HPLC, typical)
• CAS Number: 129954-34-3
• Molecular Formula: C₃₃H₅₇N₁₁O₉
• Amino Acid Sequence: Thr-Lys-Pro-Arg-Pro-Gly-Pro (TKPRPGP)

Semax is a specialised synthetic heptapeptide developed for advanced scientific exploration of neurotrophin signalling and melanocortin (ACTH-fragment) related pathways, commonly studied in models of neuroprotection, cognition, and stress-response biology.

• Batch tested Purity: ≥ 98% (HPLC, typical)
• CAS Number: 80714-61-0
• Molecular Formula: C₃₇H₅₁N₉O₁₀S
• Amino Acid Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)

SS-31 (Elamipretide) is a mitochondria-targeting tetrapeptide developed for experimental investigation of mitochondrial function, oxidative stress modulation, and cardiolipin-associated signalling pathways within cellular bioenergetics research.

• Batch tested purity: ≥ 99 % (HPLC, typical)
• CAS Number: 736992-21-5
• Peptide Type: Synthetic mitochondria-targeting tetrapeptide
• Amino Acid Sequence: D-Arg-Dmt-Lys-Phe-NH2 (Dmt = 2′,6′-dimethyl-L-tyrosine; D-Arg; C-terminal amide)
• Molecular Formula: C32H49N9O5
• Molecular Weight: 639.8

Tesamorelin is a synthetic growth hormone–releasing hormone (GHRH) analogue developed for experimental investigation of pituitary receptor–mediated signalling, growth hormone regulation, and downstream endocrine pathways.

• Batch tested Purity: ≥ 98.5 % (HPLC, typical)
• CAS Number: 901758-09-6
• Molecular Formula: C221H366N72O67S (net peptide); C223H370N72O69S (mono-acetate salt, as supplied)
• Amino Acid Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (N-terminal trans-3-hexenoyl; C-terminal amide)
• Molecular Weight: 5135.91 (net peptide); 5195.96 (mono-acetate salt, as supplied)

Thymosin Alpha-1 is a synthetic immunomodulatory peptide developed for experimental investigation of T-cell signalling, immune system regulation, and peptide-mediated cellular communication pathways.

• Batch tested Purity: ≥ 98.5 % (HPLC, typical)
• CAS Number: 62304-98-7
• Molecular Formula: C129H215N33O55
• Amino Acid Sequence: Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN (28-mer, N-acetylated)

Thymalin is a thymus-derived peptide complex developed for experimental investigation of immune regulation, cell differentiation, and age-associated signalling pathways in controlled research systems.

• Batch tested Purity: ≥ 98.5 % (HPLC, typical)
• CAS Number: 63958-90-7
• Molecular Formula: C33H54N12O15