Your cart is currently empty!.
You may check out all the available products and buy some in the shop.
Continue Shopping-
Semax 10mg
£19.00Semax is a specialised synthetic heptapeptide developed for advanced scientific exploration of neurotrophin signalling and melanocortin (ACTH-fragment) related pathways, commonly studied in models of neuroprotection, cognition, and stress-response biology.
- Batch tested Purity: ≥ 98% (HPLC, typical)
- CAS Number: 80714-61-0
- Molecular Formula: C₃₇H₅₁N₉O₁₀S
- Amino Acid Sequence: Met-Glu-His-Phe-Pro-Gly-Pro (MEHFPGP)
-
SS-31 10mg
£24.99SS-31 (Elamipretide) is a mitochondria-targeting tetrapeptide developed for experimental investigation of mitochondrial function, oxidative stress modulation, and cardiolipin-associated signalling pathways within cellular bioenergetics research.
- Batch tested purity: ≥ 99 % (HPLC, typical)
- CAS Number: 736992-21-5
- Peptide Type: Synthetic mitochondria-targeting tetrapeptide
- Amino Acid Sequence: D-Arg-Dmt-Lys-Phe-NH2 (Dmt = 2′,6′-dimethyl-L-tyrosine; D-Arg; C-terminal amide)
- Molecular Formula: C32H49N9O5
- Molecular Weight: 639.8
-
Tesamorelin 10mg
£27.90Tesamorelin is a synthetic growth hormone–releasing hormone (GHRH) analogue developed for experimental investigation of pituitary receptor–mediated signalling, growth hormone regulation, and downstream endocrine pathways.
- Batch tested Purity: ≥ 98.5 % (HPLC, typical)
- CAS Number: 901758-09-6
- Molecular Formula: C221H366N72O67S (net peptide); C223H370N72O69S (mono-acetate salt, as supplied)
- Amino Acid Sequence: (trans-3-hexenoyl)-YADAIFTNSYRKVLGQLSARKLLQDIMSRQQGESNQERGARARL-NH2 (N-terminal trans-3-hexenoyl; C-terminal amide)
- Molecular Weight: 5135.91 (net peptide); 5195.96 (mono-acetate salt, as supplied)
-
Thymosin Alpha-10mg
£19.95Thymosin Alpha-1 is a synthetic immunomodulatory peptide developed for experimental investigation of T-cell signalling, immune system regulation, and peptide-mediated cellular communication pathways.
- Batch tested Purity: ≥ 98.5 % (HPLC, typical)
- CAS Number: 62304-98-7
- Molecular Formula: C129H215N33O55
- Amino Acid Sequence: Ac-SDAAVDTSSEITTKDLKEKKEVVEEAEN (28-mer, N-acetylated)
-
Thymalin 10mg
£19.90Thymalin is a thymus-derived peptide complex developed for experimental investigation of immune regulation, cell differentiation, and age-associated signalling pathways in controlled research systems.
- Batch tested Purity: ≥ 98.5 % (HPLC, typical)
- CAS Number: 63958-90-7
- Molecular Formula: C33H54N12O15
-
ARA-290 10mg
£24.90ARA-290 is a synthetic peptide derived from the non-erythropoietic region of erythropoietin (EPO), developed for experimental investigation of tissue-protective and receptor-mediated signalling pathways associated with the innate repair receptor (EPOR/CD131 complex).
- Manufactured to specification (research grade)
- CAS Number: 1208243-50-8
- Peptide Type: Synthetic EPO-derived peptide (ARA-290 / Cibinetide)
- Amino Acid Sequence: pGlu-Glu-Gln-Leu-Glu-Arg-Ala-Leu-Asn-Ser-Ser ([pE]EQLERALNSS; N-terminal pyroglutamate)
- Molecular Formula: C51H84N16O21
- Molecular Weight: 1257.3